PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_012690-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 237aa    MW: 27726.4 Da    PI: 8.8055
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_012690-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.83.3e-201360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+llv+ v ++G g+W+++ar+ g++R++k+c++rw +yl
  AHYPO_012690-RA 13 KGPWTQEEDKLLVEHVSLHGEGRWSSVARCTGLNRSGKSCRLRWVNYL 60
                     79********************************************97 PP

2Myb_DNA-binding49.31.1e-1566110147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T +E+ ++++++  +G++ W+tIar+++ gRt++++k++w+++
  AHYPO_012690-RA  66 RGQITSQEEGIIIELHSIWGNK-WSTIARYLP-GRTDNEIKNYWRTH 110
                      6888******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.259864IPR017930Myb domain
SuperFamilySSF466891.65E-3110107IPR009057Homeodomain-like
SMARTSM007171.4E-171262IPR001005SANT/Myb domain
PfamPF002492.6E-181360IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-231467IPR009057Homeodomain-like
CDDcd001671.91E-121560No hitNo description
PROSITE profilePS5129419.43265115IPR017930Myb domain
SMARTSM007176.5E-1365113IPR001005SANT/Myb domain
PfamPF002495.2E-1366110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-2368114IPR009057Homeodomain-like
CDDcd001671.84E-870111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MATCPIQNQG WRKGPWTQEE DKLLVEHVSL HGEGRWSSVA RCTGLNRSGK SCRLRWVNYL  60
RPGLKRGQIT SQEEGIIIEL HSIWGNKWST IARYLPGRTD NEIKNYWRTH FKKKERCREV  120
SNKRSKPQIL KPKPPNQQPL EAQITQIQTQ ELIPRSIKNE ETNQIVPSQD QTLNNIEEQN  180
LMMMMITTPT MIDATCHDQD GSWWESLWNF SDLMQQDYNN NNQYCSKMAL SLQNQAN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-271311427127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010666760.12e-80PREDICTED: transcription factor MYB82
TrEMBLQ20CC12e-89Q20CC1_BETVU; Fgenesh protein 125
STRINGfgenesh2_kg.5__710__AT3G30210.16e-70(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30210.16e-70myb domain protein 121